Pan paniscus (bonobo): 129395037 Help Entry 129395037         CDS       T02283                                  Name (RefSeq) cofilin-1-like   KO K05765   cofilin Organism pps  Pan paniscus (bonobo) Pathway pps04360   Axon guidance pps04666   Fc gamma R-mediated phagocytosis pps04810   Regulation of actin cytoskeleton pps05133   Pertussis pps05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:pps00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     129395037  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     129395037   09158 Development and regeneration    04360 Axon guidance     129395037  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     129395037   09171 Infectious disease: bacterial    05133 Pertussis     129395037  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pps04131]     129395037   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pps04812]     129395037    04147 Exosome [BR:pps04147]     129395037 Membrane trafficking [BR:pps04131]  Others   Actin-binding proteins    Others     129395037 Cytoskeleton proteins [BR:pps04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      129395037 Exosome [BR:pps04147]  Exosomal proteins   Proteins found in most exosomes    129395037 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  129395037 NCBI-ProteinID:  XP_054961556 LinkDB All DBs Position 1:217232649..217234724 Genome browser AA seq 85 aa AA seqDB search MASGVAISDGVIKVFTDMTVGKSSTPEEVKKRKKMVLLFCLSEGEKNIALEEGEETLVDD VGWTIDNPYTTFAKMLPDKDCCCVL NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcctctggtgtggctatctctgatggtgtcatcaaggtgttcactgacatgacagtg ggcaaatcttcgacgccagaggaggtgaagaagcgcaagaaaatggtgctgctcttctgc ctgagtgagggtgagaagaacatcgccctggaggagggcgaggagaccctggtggatgac gtgggctggaccattgacaacccctacaccacctttgccaagatgctgccagacaaagac tgctgctgtgtcctctga

DBGET integrated database retrieval system