Pan paniscus (bonobo): 129397736 Help Entry 129397736         CDS       T02283                                  Name (RefSeq) histone H3.X   KO K11253   histone H3 Organism pps  Pan paniscus (bonobo) Pathway pps04613   Neutrophil extracellular trap formation pps05034   Alcoholism pps05202   Transcriptional misregulation in cancer pps05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pps00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     129397736  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     129397736   09163 Immune disease    05322 Systemic lupus erythematosus     129397736   09165 Substance dependence    05034 Alcoholism     129397736  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pps03036]     129397736   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pps04147]     129397736 Chromosome and associated proteins [BR:pps03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129397736 Exosome [BR:pps04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129397736 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  129397736 NCBI-ProteinID:  XP_054968155 LinkDB All DBs Position 4:complement(17724056..17729485) Genome browser AA seq 147 aa AA seqDB search MARTKQTARKATAWQAPRKPLATKAARKRASPTGGIKKPHRYKPGTLALREIRKYQKSTQ LLLRKRPFQRLVREIAQAISLDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTI MPQDMQLARRLRGEGAGEPTLLGNLAL NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggcacgcaccaagcagaccgcccgcaaagccaccgcctggcaggcccccaggaagccc ctggccaccaaagccgccagaaaaagggcgtcgcctacaggagggatcaagaagcctcac cgctacaagcctggcaccctggcgctgcgggaaatcagaaagtaccagaagtccacgcag ctgctcctgcgcaagcggcccttccagcgcctggtgcgcgagatcgcccaggccatcagc ctggacctgcgcttccagagcgcggccattggcgccctgcaggaggccagcgaggcctac ctggtgcagctctttgaagacaccaacctgtgtgccatccatgccaggcgcgtcacaatt atgccccaagacatgcagctggcccgccgcctccgtggagagggtgccggagagcccacg ctcctgggaaaccttgcactctag

DBGET integrated database retrieval system