Pan paniscus (bonobo): 807881 Help Entry 807881            CDS       T02283                                  Symbol ND4L, KEF42_p05 Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism pps  Pan paniscus (bonobo) Pathway pps00190   Oxidative phosphorylation pps01100   Metabolic pathways pps04714   Thermogenesis pps04723   Retrograde endocannabinoid signaling pps05010   Alzheimer disease pps05012   Parkinson disease pps05014   Amyotrophic lateral sclerosis pps05016   Huntington disease pps05020   Prion disease pps05022   Pathways of neurodegeneration - multiple diseases pps05208   Chemical carcinogenesis - reactive oxygen species pps05415   Diabetic cardiomyopathy Module pps_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:pps00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     807881 (ND4L)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     807881 (ND4L)   09159 Environmental adaptation    04714 Thermogenesis     807881 (ND4L)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     807881 (ND4L)   09164 Neurodegenerative disease    05010 Alzheimer disease     807881 (ND4L)    05012 Parkinson disease     807881 (ND4L)    05014 Amyotrophic lateral sclerosis     807881 (ND4L)    05016 Huntington disease     807881 (ND4L)    05020 Prion disease     807881 (ND4L)    05022 Pathways of neurodegeneration - multiple diseases     807881 (ND4L)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     807881 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:pps03029]     807881 (ND4L) Enzymes [BR:pps01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      807881 (ND4L) Mitochondrial biogenesis [BR:pps03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     807881 (ND4L) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  807881 NCBI-ProteinID:  NP_008207 UniProt:  Q35588 E0XIC9 LinkDB All DBs Position MT:9889..10185 Genome browser AA seq 98 aa AA seqDB search MPLIYMNIMLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMTTLMTLNTHSLLANIVP ITMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgcctcttatttatataaatattatactagcatttaccatctcacttctaggaatacta gtataccgctcacacctaatatcttctctactatgcctagaaggaataatactatcatta ttcatcataaccaccctcataaccctcaatacccactccctcttagccaatattgtaccc atcaccatactagtctttgctgcctgcgaggcagcagtaggtctagcactattagtttca atctctaacacgtatggcctagactacgtacataatctaaacctactccaatgctaa

DBGET integrated database retrieval system