Podospora pseudoanserina: QC764_119070 Help Entry QC764_119070      CDS       T09816                                  Symbol RAC1 Name (RefSeq) Rho GTPase protein rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ppsa  Podospora pseudoanserina Pathway ppsa04145   Phagosome ppsa04148   Efferocytosis ppsa04517   IgSF CAM signaling ppsa04518   Integrin signaling ppsa04620   Toll-like receptor signaling pathway ppsa05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ppsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     QC764_119070 (RAC1)    04518 Integrin signaling     QC764_119070 (RAC1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     QC764_119070 (RAC1)    04148 Efferocytosis     QC764_119070 (RAC1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     QC764_119070 (RAC1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     QC764_119070 (RAC1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppsa04131]     QC764_119070 (RAC1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppsa04147]     QC764_119070 (RAC1)    04031 GTP-binding proteins [BR:ppsa04031]     QC764_119070 (RAC1) Membrane trafficking [BR:ppsa04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     QC764_119070 (RAC1)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     QC764_119070 (RAC1)   Macropinocytosis    Ras GTPases     QC764_119070 (RAC1)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     QC764_119070 (RAC1) Exosome [BR:ppsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    QC764_119070 (RAC1)   Exosomal proteins of other body fluids (saliva and urine)    QC764_119070 (RAC1)   Exosomal proteins of colorectal cancer cells    QC764_119070 (RAC1)   Exosomal proteins of bladder cancer cells    QC764_119070 (RAC1) GTP-binding proteins [BR:ppsa04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     QC764_119070 (RAC1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  87964035 NCBI-ProteinID:  XP_062806241 LinkDB All DBs Position 1:complement(6807164..6809916) Genome browser AA seq 200 aa AA seqDB search MATPPVQSIKCVVTGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSASVTVDGRPISLGL WDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPPSFDNVKAKWWPEIGHHAPNIPIVLVGT KLDARDDPNTLKTMAEKRWSPITYPMGLALAKEIGAYKYAECSALTQMGLKTVFDYAIRA VIEPKAAPQTKKKSSKCTLL NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atggccaccccgcccgtccagtcgatcaagtgcgtcgtcacaggtgatggtgccgtcggc aagacatgtctgctcatctcctacacaacgaatgctttccccggcgaatacatccccacg gtattcgacaactactctgcgagcgtaactgttgatggaaggcccatcagtttggggttg tgggatacggccggtcaagaagattacgacagactgcggcctctctcatacccccagacc gatgttttcctcatctgcttctccctcgtcagccctccttcgtttgacaacgtgaaggcc aagtggtggcccgaaatcggacatcacgctcccaatattcccattgtgctggttggcacc aagctggacgccagagatgaccctaatacgctcaagacaatggccgagaagcggtggtcg cctattacctaccccatgggattggcccttgccaaggagattggagcttacaagtacgcc gaatgctctgccttgacacagatgggtctcaagaccgtctttgactatgccatcagagcc gtcattgagcccaaggccgctcctcagacgaagaagaagtcgtccaagtgcacgctcctc tga

DBGET integrated database retrieval system