Podospora pseudoanserina: QC764_211240 Help Entry QC764_211240      CDS       T09816                                  Symbol URM1 Name (RefSeq) Ubiquitin-related modifier 1   KO K12161   ubiquitin related modifier 1 Organism ppsa  Podospora pseudoanserina Pathway ppsa04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:ppsa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     QC764_211240 (URM1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:ppsa03016]     QC764_211240 (URM1)    04121 Ubiquitin system [BR:ppsa04121]     QC764_211240 (URM1) Transfer RNA biogenesis [BR:ppsa03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     QC764_211240 (URM1) Ubiquitin system [BR:ppsa04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    QC764_211240 (URM1) SSDB OrthologParalogGFIT Motif Pfam:  Urm1 ThiS Motif Other DBs NCBI-GeneID:  87965694 NCBI-ProteinID:  XP_062803700 UniProt:  A0ABR0IIP8 LinkDB All DBs Position 2:4142606..4145211 Genome browser AA seq 110 aa AA seqDB search MAPEPETMPISVDFLGGLDTLFSNKTSHTISLPLLNPSDSSPANVGFLISYLVKHHLKHP RTEFFVQGDGHLTPGILVLINEADWELEGEEECELKAGDKVVFVSTMHGG NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggcaccagaaccagagaccatgcccatctcggtggatttcctaggcggcctagacacc ctcttctccaacaaaacatcccacaccatctccctccccctcctcaacccctccgactcc tcccccgccaacgtcggcttcctaatctcatacctcgtcaagcaccacctcaagcaccca aggacagaatttttcgtgcaaggcgatggtcacttaacacccggcatactggtcctcatc aacgaggcagactgggaactcgaaggggaggaagaatgcgagctcaaggcaggggataaa gttgtttttgtctcgaccatgcacggtggttag

DBGET integrated database retrieval system