Podospora pseudoanserina: QC764_305250 Help Entry QC764_305250      CDS       T09816                                  Symbol ATG8 Name (RefSeq) ubiquitin-like protein atg8   KO K08341   GABA(A) receptor-associated protein Organism ppsa  Podospora pseudoanserina Pathway ppsa04136   Autophagy - other ppsa04138   Autophagy - yeast ppsa04139   Mitophagy - yeast ppsa04145   Phagocytosis ppsa04156   Integrated stress response (ISR) signaling pathway Brite KEGG Orthology (KO) [BR:ppsa00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     QC764_305250 (ATG8)    04138 Autophagy - yeast     QC764_305250 (ATG8)    04136 Autophagy - other     QC764_305250 (ATG8)    04139 Mitophagy - yeast     QC764_305250 (ATG8)   09143 Cell growth and death    04156 Integrated stress response (ISR) signaling pathway     QC764_305250 (ATG8)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppsa04131]     QC764_305250 (ATG8)    04121 Ubiquitin system [BR:ppsa04121]     QC764_305250 (ATG8)    03029 Mitochondrial biogenesis [BR:ppsa03029]     QC764_305250 (ATG8) Membrane trafficking [BR:ppsa04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     QC764_305250 (ATG8) Ubiquitin system [BR:ppsa04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    QC764_305250 (ATG8) Mitochondrial biogenesis [BR:ppsa03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     QC764_305250 (ATG8) SSDB OrthologParalogGFIT Motif Pfam:  ATG8 APG12 BT_3535-like Motif Other DBs NCBI-GeneID:  87966502 NCBI-ProteinID:  XP_062801645 UniProt:  A0ABR0ICU6 LinkDB All DBs Position 3:complement(1830804..1832558) Genome browser AA seq 121 aa AA seqDB search MRSKFKDEHPFEKRKAEAERIRQKYADRIPVICEKVEKSDIATIDKKKYLVPADLTVGQF VYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGGFET A NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgagatccaagtttaaggacgagcatccctttgagaagcgcaaggccgaggccgagcgc attcgtcaaaaatatgctgaccgcattcccgttatttgtgagaaggttgaaaagagcgac atcgctaccatcgacaagaagaagtacctcgttccggccgatctcaccgtgggccagttc gtctacgttattcgcaaacggattaaactctccccagagaaggccatcttcatcttcgtt gatgaggtcctgcctccaaccgctgctctcatgagcagcatctatgaagagcacaaggat gaggacggattcctttacatcacatactcgggcgagaacaccttcggtggtttcgagact gcctaa

DBGET integrated database retrieval system