Podospora pseudoanserina: QC764_610600 Help Entry QC764_610600      CDS       T09816                                  Symbol SEM1 Name (RefSeq) 26S proteasome complex subunit   KO K10881   26 proteasome complex subunit DSS1 Organism ppsa  Podospora pseudoanserina Pathway ppsa03050   Proteasome ppsa03440   Homologous recombination Brite KEGG Orthology (KO) [BR:ppsa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     QC764_610600 (SEM1)   09124 Replication and repair    03440 Homologous recombination     QC764_610600 (SEM1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ppsa03019]     QC764_610600 (SEM1)    04131 Membrane trafficking [BR:ppsa04131]     QC764_610600 (SEM1)    03051 Proteasome [BR:ppsa03051]     QC764_610600 (SEM1)    03400 DNA repair and recombination proteins [BR:ppsa03400]     QC764_610600 (SEM1) Messenger RNA biogenesis [BR:ppsa03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      QC764_610600 (SEM1) Membrane trafficking [BR:ppsa04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     QC764_610600 (SEM1) Proteasome [BR:ppsa03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      QC764_610600 (SEM1) DNA repair and recombination proteins [BR:ppsa03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      QC764_610600 (SEM1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DSS1_SEM1 Motif Other DBs NCBI-GeneID:  87970406 NCBI-ProteinID:  XP_062798294 LinkDB All DBs Position 6:4006570..4007448 Genome browser AA seq 92 aa AA seqDB search MATSKAPSADPKSSSDLPAEQPQQQKQQTLEEDDEFEDFPVDDWQADDTEATQNQQPQHL WEESWDDDDTTDDFSNQLKEELKRVEASKNKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggccacctccaaagccccctctgcggaccccaagtccagctccgacctccccgccgag cagccccaacagcaaaagcagcagaccctcgaggaggatgacgagtttgaggacttccct gtcgatgactggcaagcggatgacacagaagccacccagaaccagcagccacaacatctc tgggaggagtcctgggacgacgatgacacgacagatgatttttccaaccaactcaaggag gagcttaaaagggtcgaggcgtccaagaacaaacggtga

DBGET integrated database retrieval system