Paenibacillus psychroresistens: EHS13_28165 Help Entry EHS13_28165       CDS       T06328                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppsc  Paenibacillus psychroresistens Pathway ppsc01100   Metabolic pathways ppsc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppsc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EHS13_28165    00074 Mycolic acid biosynthesis     EHS13_28165   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EHS13_28165 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF592 Motif Other DBs NCBI-ProteinID:  QGQ98481 UniProt:  A0A6B8RQ29 LinkDB All DBs Position complement(6219518..6219745) Genome browser AA seq 75 aa AA seqDB search MKKIELLNEIKEILQVDMELTDDMKLEEIEDWDSLAIVSVISLFDLLLSVNITSQQVNNC RTIQDLLNLTNGKLE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgaagaaaattgaactattaaatgaaattaaggaaatattacaggtagacatggaatta acagatgatatgaaactggaggaaattgaagactgggattcattagcaattgttagtgta atttcacttttcgaccttttgctttcagtgaatattacttcacaacaagtgaataattgc agaacaatccaagatttattaaatctgactaacggaaaattagaatga

DBGET integrated database retrieval system