Ectopseudomonas oleovorans: BN5_0521 Help Entry BN5_0521          CDS       T03772                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism ppse  Ectopseudomonas oleovorans Pathway ppse02024   Quorum sensing ppse03018   RNA degradation Brite KEGG Orthology (KO) [BR:ppse00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     BN5_0521 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BN5_0521 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ppse03019]     BN5_0521 (hfq)    03036 Chromosome and associated proteins [BR:ppse03036]     BN5_0521 (hfq) Messenger RNA biogenesis [BR:ppse03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      BN5_0521 (hfq) Chromosome and associated proteins [BR:ppse03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BN5_0521 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Gag_p24_C Motif Other DBs NCBI-ProteinID:  CDM39135 UniProt:  W6QQA6 LinkDB All DBs Position 568267..568527 Genome browser AA seq 86 aa AA seqDB search MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVRLPSAGDAEQADGEPGNA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacctgaataccctgcgtaaggaacgcgtc cctgtttccatctatctggtcaacggcatcaagctgcaaggccagatcgaatccttcgac cagtttgtcattctgctgaagaataccgtcagccagatggtctacaaacacgccatttcc accgtcgtgcctagccgtccggtacgcctgccgagtgctggcgatgccgagcaggcagat ggcgagccaggtaacgcctga

DBGET integrated database retrieval system