Ectopseudomonas oleovorans: BN5_1457 Help Entry BN5_1457          CDS       T03772                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism ppse  Ectopseudomonas oleovorans Pathway ppse01100   Metabolic pathways ppse01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppse00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BN5_1457 (acpP)    00074 Mycolic acid biosynthesis     BN5_1457 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BN5_1457 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  CDM40056 UniProt:  W6R0W1 LinkDB All DBs Position 1554396..1554632 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYVTAHAQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgttgctgagcaacttggcgtcaaggaa gaggaagtaaccaacagcgcttccttcgttgaagacctgggtgccgactctcttgacacc gttgagctggtgatggctctcgaggaagaattcgagaccgagatcccggacgagcaagct gagaaaatcaccaccgttcaggaagctatcgactacgtgactgcccacgcgcaataa

DBGET integrated database retrieval system