KEGG   Ectopseudomonas oleovorans: BN5_4496
Entry
BN5_4496          CDS       T03772                                 
Symbol
atpC
Name
(GenBank) ATP synthase F1, epsilon subunit
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
ppse  Ectopseudomonas oleovorans
Pathway
ppse00190  Oxidative phosphorylation
ppse01100  Metabolic pathways
Module
ppse_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:ppse00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BN5_4496 (atpC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:ppse00194]
    BN5_4496 (atpC)
Photosynthesis proteins [BR:ppse00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BN5_4496 (atpC)
SSDB
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE TPR_4
Other DBs
NCBI-ProteinID: CDM43030
UniProt: W6R1S5
LinkDB
Position
complement(4669972..4670406)
AA seq 144 aa
MAMSVHCDIVSAEEELFSGLVEMVIAHGHLGDLGILPGHTPLLTDLKPGPVRVIKQGGTE
EVFYISGGFLEVQPSMVKVLADTAVRAGDLDEAAAIEARKAAEKALSEKGTEFDYGSAAA
RLAEAAAQLRTIEEMRKKFGGRIR
NT seq 435 nt   +upstreamnt  +downstreamnt
atggctatgtcagtccactgcgatatcgtcagtgcggaagaagagctgttctcggggctg
gtggaaatggtcatcgcccacggtcacctcggtgacctgggtatcctgccgggccacacc
ccgctgctgaccgatctcaagccgggtccggtgcgagtgatcaagcagggtggcaccgag
gaggtgttctacatctccggtggcttcctggaggttcagccgagcatggtgaaggtactt
gccgacaccgctgttcgcgccggcgacctggatgaagccgccgccatcgaggcgcgcaag
gcggccgagaaggcgctgagcgaaaagggcaccgagttcgactacggcagtgcggcagca
cgcctggccgaggcagctgcccagctgcgcaccatcgaagagatgcgcaagaagttcggc
ggccgcatccgctga

DBGET integrated database retrieval system