Penicillium psychrofluorescens: 300789130 Help Entry 300789130         CDS       T11417                                  Symbol PFLUO_LOCUS3409 Name (RefSeq) uncharacterized protein   KO K03358   anaphase-promoting complex subunit 11 Organism ppsf  Penicillium psychrofluorescens Pathway ppsf04111   Cell cycle - yeast ppsf04113   Meiosis - yeast ppsf04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ppsf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     300789130 (PFLUO_LOCUS3409)  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     300789130 (PFLUO_LOCUS3409)    04113 Meiosis - yeast     300789130 (PFLUO_LOCUS3409)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ppsf04121]     300789130 (PFLUO_LOCUS3409)    03036 Chromosome and associated proteins [BR:ppsf03036]     300789130 (PFLUO_LOCUS3409) Ubiquitin system [BR:ppsf04121]  Ubiquitin ligases (E3)   Multi subunit type E3    APC/C     Ring finger protein      300789130 (PFLUO_LOCUS3409) Chromosome and associated proteins [BR:ppsf03036]  Eukaryotic type   Sister chromatid separation proteins    APC/C complex     300789130 (PFLUO_LOCUS3409) SSDB OrthologParalogGFIT Motif Pfam:  zf-ANAPC11 zf-rbx1 Motif Other DBs NCBI-GeneID:  300789130 NCBI-ProteinID:  XP_073637486 UniProt:  A0ACE1C1J6 LinkDB All DBs Position 2:<3273136..>3273414 Genome browser AA seq 59 aa AA seqDB search MKVVIKEWNAIATWHWDMPEDDVCGICRVQFDSTCPTCKFPGDDCSLCEDLVGLVLTNV NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atgaaggtcgtcatcaaggagtggaatgctattgccacctggcactgggacatgcccgag gacgatgtctgtggcatctgtcgcgtccagttcgatagcacctgtcccacctgcaaattc cccggcgatgactgctccctatgtgaggatctggtcggtttggttctcacgaatgtctag

DBGET integrated database retrieval system