Pseudomonas psychrophila: G5J76_02085 Help Entry G5J76_02085       CDS       T06988                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism ppsh  Pseudomonas psychrophila Brite KEGG Orthology (KO) [BR:ppsh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppsh03036]     G5J76_02085 Chromosome and associated proteins [BR:ppsh03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     G5J76_02085 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asd-4 ZapB Motif Other DBs NCBI-ProteinID:  QIE31101 LinkDB All DBs Position 488770..488979 Genome browser AA seq 69 aa AA seqDB search MEDTDLHALMARLELLISRVEQLNRQNALLIAQEKTWREERAHLIEKNEIARHKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaccgacctgcatgcactgatggctagactcgagttgctgattagccgagtc gagcaactaaaccgccaaaacgcactcttaattgctcaggaaaagacttggcgcgaggaa cgcgcgcacctcattgaaaaaaacgaaatcgcccgacacaaggtggaatcgatgatttcg cgcctcaaagccctggagcaagactcatga

DBGET integrated database retrieval system