Pseudomonas oryzihabitans PRS08-11306: BJP27_10880 Help Entry BJP27_10880       CDS       T05074                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppsl  Pseudomonas oryzihabitans PRS08-11306 Pathway ppsl01100   Metabolic pathways ppsl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppsl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BJP27_10880    00074 Mycolic acid biosynthesis     BJP27_10880   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BJP27_10880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  APQ11980 LinkDB All DBs Position 2421864..2422124 Genome browser AA seq 86 aa AA seqDB search MTDLNLELKGLIIEALGLEDVTVDDIGDDQTLFGEGLGLDSVDALELGLAIQKRYGIRID AEAKDTRTHFASVNALAAFVAAQRAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgactgatctcaatctcgagctcaaaggcctgatcatcgaggcgctcggcctcgaggac gtcaccgtcgacgacatcggcgacgaccagaccctgttcggcgaaggcctgggcctggat tcggtggacgccctggagctgggcctggcgatccagaagcgctacggcatccgcatcgac gccgaagccaaggacacccgcacccatttcgccagcgtcaacgccctcgcggccttcgtc gccgcccagcgcgccgcctga

DBGET integrated database retrieval system