Podospora pseudopauciseta: QC763_104370 Help Entry QC763_104370      CDS       T09815                                  Symbol DYN2 Name (RefSeq) Dynein light chain   KO K10418   dynein light chain LC8-type Organism ppsp  Podospora pseudopauciseta Pathway ppsp04814   Motor proteins Brite KEGG Orthology (KO) [BR:ppsp00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     QC763_104370 (DYN2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ppsp03037]     QC763_104370 (DYN2)    04812 Cytoskeleton proteins [BR:ppsp04812]     QC763_104370 (DYN2) Cilium and associated proteins [BR:ppsp03037]  Motile cilia and associated proteins   Dynein arm    QC763_104370 (DYN2) Cytoskeleton proteins [BR:ppsp04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      QC763_104370 (DYN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  87927348 NCBI-ProteinID:  XP_062769911 LinkDB All DBs Position 1:complement(1633649..1635452) Genome browser AA seq 106 aa AA seqDB search MAGDDTKPAAGNTSPVAREKLDAQIKSADMSEELQQEVIEVAQEAMAKYSVEKDIAQHIK RTFDERKGPTWHCIVGRHFGSFVTHETKHFIYFYLGHCAILLFKTQ NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggcaggagacgataccaagcccgctgctgggaacacatcccctgtcgcgagggagaag cttgatgcccagatcaagagcgccgacatgtccgaagaattacaacaggaggtcattgaa gtcgcccaggaggccatggccaagtactccgttgagaaggatatcgctcagcacatcaag agaacatttgatgaaagaaagggacctacctggcactgcatcgtaggccgccactttggc agcttcgtgacccacgaaaccaagcacttcatctacttctacctcggtcactgcgccatc ctcctcttcaagacccagtag

DBGET integrated database retrieval system