Podospora pseudopauciseta: QC763_205210 Help Entry QC763_205210      CDS       T09815                                  Name (RefSeq) uncharacterized protein   KO K10740   replication factor A3 Organism ppsp  Podospora pseudopauciseta Pathway ppsp03030   DNA replication ppsp03420   Nucleotide excision repair ppsp03430   Mismatch repair ppsp03440   Homologous recombination ppsp03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:ppsp00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     QC763_205210    03420 Nucleotide excision repair     QC763_205210    03430 Mismatch repair     QC763_205210    03440 Homologous recombination     QC763_205210    03460 Fanconi anemia pathway     QC763_205210  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ppsp03032]     QC763_205210    03400 DNA repair and recombination proteins [BR:ppsp03400]     QC763_205210 DNA replication proteins [BR:ppsp03032]  Eukaryotic type   DNA Replication Elongation Factors    RPA (replication protein A)     QC763_205210 DNA repair and recombination proteins [BR:ppsp03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     RPA (replication factor A)      QC763_205210    MMR (mismatch excision repair)      QC763_205210   DSBR (double strand breaks repair)    HR (homologous recombination)      QC763_205210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rep_fac-A_3 Motif Other DBs NCBI-GeneID:  87929906 NCBI-ProteinID:  XP_062768364 LinkDB All DBs Position 2 Genome browser AA seq 105 aa AA seqDB search METSTPRVTCAYLNSYVGRNVMVVGKVAQIRGEDAIIDADGNISCKLNRDAHLVPGNGVQ VIGKVNPDLSVKVLSSLDLGTGVDYNLANTVVEITHQHKNLFTNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggagacctcaacaccaagagttacctgtgcctacctcaactcatacgtcggcaggaat gttatggtcgtgggcaaagtcgcccaaatccgcggtgaagacgccatcatcgacgccgac ggcaacatctcttgcaagctgaatcgcgatgcccacctggtcccgggcaacggtgtccaa gtcattggcaaagtaaacccagacctgtcagtcaaagtcctcagctcccttgacctgggc acgggcgttgactacaaccttgccaacacagtggtggagataacacatcagcacaagaac ttgtttaccaacgagtag

DBGET integrated database retrieval system