Podospora pseudopauciseta: QC763_709860 Help Entry QC763_709860      CDS       T09815                                  Symbol cdc42 Name (RefSeq) GTPase Cdc42   KO K04393   cell division control protein 42 Organism ppsp  Podospora pseudopauciseta Pathway ppsp04011   MAPK signaling pathway - yeast ppsp04144   Endocytosis ppsp04517   IgSF CAM signaling ppsp04518   Integrin signaling ppsp05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ppsp00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     QC763_709860 (cdc42)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     QC763_709860 (cdc42)    04518 Integrin signaling     QC763_709860 (cdc42)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     QC763_709860 (cdc42)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     QC763_709860 (cdc42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppsp04131]     QC763_709860 (cdc42)    03036 Chromosome and associated proteins [BR:ppsp03036]     QC763_709860 (cdc42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppsp04147]     QC763_709860 (cdc42)    04031 GTP-binding proteins [BR:ppsp04031]     QC763_709860 (cdc42) Membrane trafficking [BR:ppsp04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     QC763_709860 (cdc42)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     QC763_709860 (cdc42)   Macropinocytosis    Ras GTPases     QC763_709860 (cdc42) Chromosome and associated proteins [BR:ppsp03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     QC763_709860 (cdc42) Exosome [BR:ppsp04147]  Exosomal proteins   Exosomal proteins of microglial cells    QC763_709860 (cdc42)   Exosomal proteins of breast milk    QC763_709860 (cdc42) GTP-binding proteins [BR:ppsp04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     QC763_709860 (cdc42) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  87936320 NCBI-ProteinID:  XP_062761987 LinkDB All DBs Position 7 Genome browser AA seq 194 aa AA seqDB search MVLGTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGDEPYTLGLFDT AGQEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVREKWFPEVHHHCPGVPCLIVGTQVD LRDDPSVQQKLAKQKMSPVSKADGERMAKDLGAVKYVECSALTQYKLKDVFDEAIVAALE PPTPKKSRHKCQIL NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atggttttaggaaccatcaagtgcgtggtcgtcggtgacggtgctgtcggaaagacttgt cttctgatcagctatacaacgaacaagttcccctcggaatatgtcccgaccgtcttcgac aactatgccgtcacagtcatgatcggagatgagccgtacacattgggcctgtttgatact gccgggcaagaagattacgaccgcctgcgtcctctctcatatccacagaccgacgtcttc ttggtctgcttcagcgtcacatctccggcctcgttcgaaaacgtccgcgagaagtggttc cccgaagtgcaccaccactgccccggcgttccctgcctgatcgtcggcactcaggtggat ttgcgtgacgatccttcagtccagcagaagctggccaagcaaaagatgtcgcccgtgtca aaagccgacggtgagaggatggcgaaggatctcggtgctgtcaaatatgtcgagtgcagt gccctcacgcagtacaagttgaaggatgtctttgatgaggctattgttgctgccttagaa ccacccacacccaagaagagccgccacaagtgccagattctttga

DBGET integrated database retrieval system