Persicobacter psychrovividus: PEPS_44130 Help Entry PEPS_44130        CDS       T09740                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppsv  Persicobacter psychrovividus Pathway ppsv01100   Metabolic pathways ppsv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppsv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PEPS_44130    00074 Mycolic acid biosynthesis     PEPS_44130   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PEPS_44130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BDD02133 LinkDB All DBs Position pPP6:complement(88993..89250) Genome browser AA seq 85 aa AA seqDB search MDTFKIKLKEQLIEALNLEDMTPKEIEDDAPLFGDGLGLDSIDALELIVLLEKEYDIKLA DPEKSRAVFASVNTLASFITEEQGQ NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggacacgtttaaaattaaacttaaagagcaactaatagaagcattgaatttggaagat atgacgccaaaggagattgaagatgatgctcctctatttggtgatggattgggtttagac tccatcgatgcacttgagttgatcgttctcttggaaaaagaatacgatataaaattggct gatcctgaaaagagtcgtgcggtctttgcatcggtaaataccttagcatcattcattaca gaagaacaaggacaatag

DBGET integrated database retrieval system