Pseudomonas versuta: AOC04_19410 Help Entry AOC04_19410       CDS       T04081                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism ppsy  Pseudomonas versuta Brite KEGG Orthology (KO) [BR:ppsy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppsy03036]     AOC04_19410 Chromosome and associated proteins [BR:ppsy03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     AOC04_19410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asd-4 ZapB Motif Other DBs NCBI-ProteinID:  ALE90219 UniProt:  A0A0M3UF14 LinkDB All DBs Position 4346902..4347111 Genome browser AA seq 69 aa AA seqDB search MEDTDLHALMARLELLINRVEQLNRQNGLLVAQEKTWREERAHLIEKNEIARHKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaccgacctgcatgcactgatggccagactcgagttactgatcaaccgggtc gagcaacttaaccgtcaaaacggactcttagtagctcaggaaaagacttggcgcgaggaa cgcgcgcacctcattgaaaaaaacgaaatcgcccgacacaaggtggaatcgatgatttcg cgcctcaaagccctggagcaagactcatga

DBGET integrated database retrieval system