KEGG   Pseudomonas versuta: AOC04_21215
Entry
AOC04_21215       CDS       T04081                                 
Name
(GenBank) taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
ppsy  Pseudomonas versuta
Pathway
ppsy00430  Taurine and hypotaurine metabolism
ppsy00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AOC04_21215
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AOC04_21215
Enzymes [BR:ppsy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     AOC04_21215
SSDB
Motif
Pfam: TauD ATP_bind_3
Other DBs
NCBI-ProteinID: ALE90558
UniProt: A0ABX3E4M3
LinkDB
Position
complement(4735121..4735954)
AA seq 277 aa
MSLTITPISSALGAQIDGVDLTRPLSPQQRDAIEQALLEHQVIFFKDQSITPQQQARFAA
NFGDLHIHPIYPNVPEQPEVLVLDTAVTDVRDNAVWHTDVTFLPTPAMGAVLSAKQLPAF
GGDTLWASGIAAFEGLSRPLQVLLDGLTATHDFTKSFPLERFGSTPEDFLRWDQTRKNNP
PLSHPVVRTHPVSGRKSLFVNEGFTTKINELSEAESEAILKLLFAHSTRPEYTIRWRWQE
NDVAFWDNRVTQHYAVDDYRPNRRVMHRATILGDAPF
NT seq 834 nt   +upstreamnt  +downstreamnt
atgagcctgaccattaccccgattagctctgcccttggcgcccagattgacggcgttgac
ctgacccgccccctgagcccgcagcagcgcgatgccatcgagcaagcgctgcttgagcat
caggttattttcttcaaagaccagtcgatcaccccgcagcagcaagcacgctttgcggcc
aattttggtgatctgcatattcatccgatctatcccaacgtacctgagcagcccgaagtg
ctggtgctggacaccgccgtcaccgacgtgcgtgacaacgcggtatggcacaccgacgta
acctttttgccgaccccggcgatgggtgcggtgctgagtgccaagcagttgccggccttt
ggcggcgataccttgtgggccagcgggattgcagcgttcgaggggctgtccaggccattg
caagtgttgctggatggtttgactgcaacccacgacttcaccaagtcgttcccgctggag
cgtttcggctctacacctgaagattttctgcgctgggaccagacccgtaaaaacaacccg
ccgctgtcgcacccggtggtacgcacgcacccggtcagcggccgcaagtcgctgttcgtc
aacgaaggcttcaccacgaaaatcaatgagctttcagaggctgaaagcgaagcgattttg
aagctgctgttcgcccacagcacccgccccgagtacaccatccgctggcgctggcaagag
aacgacgtcgcgttctgggacaaccgtgtgacccagcattacgccgtggatgattaccgc
ccgaaccggcgcgtgatgcatcgcgcgacaatcctgggtgacgcgcccttctga

DBGET integrated database retrieval system