Pseudomonas putida S16: PPS_5055 Help Entry PPS_5055          CDS       T01570                                  Name (GenBank) conserved hypothetical protein   KO K09892   cell division protein ZapB Organism ppt  Pseudomonas putida S16 Brite KEGG Orthology (KO) [BR:ppt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppt03036]     PPS_5055 Chromosome and associated proteins [BR:ppt03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PPS_5055 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ADIP Filament Asd-4 TPR_MLP1_2 ZapB Motif Other DBs NCBI-ProteinID:  AEJ15582 LinkDB All DBs Position 5738714..5738932 Genome browser AA seq 72 aa AA seqDB search MQPTQENDLQALMSRFELLIERVEQLKRQNALLVAQEKSWREERAHLIEKNEIAKRKVES MILRLKALEQDS NT seq 219 nt NT seq  +upstreamnt  +downstreamnt gtgcaacccacgcaagagaacgacctgcaggcactgatgagccgattcgagttgctgatc gaacgtgtcgagcaactaaaacggcaaaatgcactcctagtagctcaggaaaagtcctgg cgcgaagagcgcgcccacctcatcgaaaagaacgagatcgccaagcgcaaggtcgagtcg atgattttacgcctcaaggctctggagcaagactcatga

DBGET integrated database retrieval system