Pseudomonas putida KT2440: PP_1613 Help Entry PP_1613           CDS       T00114                                  Symbol ftsB Name (GenBank) essential cell division protein   KO K05589   cell division protein FtsB Organism ppu  Pseudomonas putida KT2440 Brite KEGG Orthology (KO) [BR:ppu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppu03036]     PP_1613 (ftsB) Chromosome and associated proteins [BR:ppu03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PP_1613 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC NRBF2 ACCA_BT YabA HALZ Motif Other DBs NCBI-ProteinID:  AAN67234 UniProt:  Q88MF8 LinkDB All DBs Position 1810408..1810689 Genome browser AA seq 93 aa AA seqDB search MRSPYWLFLVLLLLLGGLQYRLWVGNGSLAQVTELKQQIADQHAENERLLERNRVLDAEV LELKKGMETVEERARHELGMVKEGETLFQLPQK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtccctattggttgttcctcgttctgctcttgctgttgggtggcctgcagtac cgcctgtgggtgggtaacggcagcctggcgcaagtgaccgaactgaagcagcagattgcc gatcagcatgccgaaaacgagcgcttgctcgagcgtaatcgtgtgctcgatgctgaagtg ctagagctgaaaaaaggcatggagaccgttgaagaacgggcccgccatgaattggggatg gtcaaagagggcgaaaccctcttccagttgccacagaaatga

DBGET integrated database retrieval system