Pseudomonas putida KT2440: PP_3466
Help
Entry
PP_3466 CDS
T00114
Name
(GenBank) putative ABC efflux transporter, permease/ATP-binding protein
KO
K06147
ATP-binding cassette, subfamily B, bacterial
Organism
ppu
Pseudomonas putida KT2440
Brite
KEGG Orthology (KO) [BR:
ppu00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
ppu02000
]
PP_3466
Transporters [BR:
ppu02000
]
ABC transporters, eukaryotic type
ABCB (MDR/TAP) subfamily
ABCB-BAC subgroup
PP_3466
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_membrane
ABC_tran
SMC_N
AAA_16
AAA_29
ABC_membrane_3
AAA_22
SbcC_Walker_B
RsgA_GTPase
ABC_membrane_2
AAA_28
AAA_18
AAA_21
Motif
Other DBs
NCBI-ProteinID:
AAN69068
UniProt:
Q88H94
LinkDB
All DBs
Position
complement(3931767..3933476)
Genome browser
AA seq
569 aa
AA seq
DB search
MDSSDPVLMRQALAWLYGFVRPHRRAIGLLLSLSLGASLLALAQPWLVKTLIDEGLLAKD
YQTLWHMAAIMIGAGLLGTVLAGVNRYLHTRLSGRILFALRDDLYRHLQQLSPTFYGRRR
IGDILSRLDGDVAEIQRFAVDSLFSAVSAVIGLVGAVTLMLMLSWQLSLLLALLVPIEVL
WLRWMRRKVEREVRNLRERSADVSSFLVETLPAMKFIQAAGQQGREAGRLDQLGQGYMRQ
LLKVQVTEFFTQAIPGTLTSWCRACAFLVGGWWVIQGTWQLGALIAFSTYMGMAVGPVQS
LLGLYVAVQRMAVSLGRVMELKQEAVAVHQTANPQPIPDGPGELRLEALSFAHEGRQGAV
LNNVQVSIPGGLKVAISGASGVGKSTLIDLLQRFYDPDAGRILLDGVDLRDLDLAALRRR
IAVVSQDIVLFRGTLAQNLAYGVPEASRDELERVVRLARLDSLVDSLPLGLDGLLGERGQ
QLSGGQKQRIAIARAVLQAPAILVLDEATSAVDEATEREVIAAIDQLFAGRTRILISHRA
STLADADLQLQLHDGQLQVLAQEVIKHGH
NT seq
1710 nt
NT seq
+upstream
nt +downstream
nt
gtggattccagcgaccctgtactcatgcgccaggcgttggcctggctgtatggtttcgtg
cgcccccatcggcgtgccatcggcctgttgctcagcttgtcgctgggtgcatcgctgctg
gcgctggcgcaaccctggctggtcaagaccctgatcgatgaggggctgctggccaaggat
taccaaacgctttggcacatggcggcaatcatgatcggcgcgggcctgctgggcactgtg
ctggctggggtcaaccgctacctgcatacgcgcttgtcggggcgcatcctgtttgccctg
cgtgacgacctttaccgccatctgcagcaattgtcaccgaccttttacgggcggcggcgt
atcggcgacattctttcgcggctggatggcgatgtggcagagatccagcgctttgccgtg
gactcgctgttctcggcggtgtcggcggtgatcggcctggtgggcgcggtgacgttgatg
ctgatgctgtcgtggcagttgtcgctgttgctggcgctgctggtgccgatcgaagtgctg
tggctgcgctggatgcggcgcaaggtggagcgcgaagtgcgcaacttgcgtgagcgctcg
gcggatgtgtcgtctttcctggtcgagaccctgccggcgatgaagttcattcaggcggcc
ggccagcaaggccgggaagcagggcgcctggaccagcttgggcaaggttacatgcgtcag
ctgctgaaggtgcaggtgaccgaattcttcacccaggccatccccggcacgctcacctcg
tggtgccgcgcctgtgcgttcctggtcggtggctggtgggtgatccagggcacctggcaa
ctgggcgcgttgatcgctttttctacttacatgggcatggcggttgggccggtgcagagc
ctgttgggcttgtacgtggcggtgcagcgcatggctgtcagcctgggaagggtgatggaa
ttgaagcaggaagcggtagcagtacatcagaccgccaacccgcagcccatccccgatggc
cccggcgagttgcgcctggaggcgctgagctttgcccatgaggggcgtcagggtgcggta
ctgaacaacgtgcaggtgagcatcccgggtggcctgaaagtcgccatcagcggtgcctcc
ggggtgggcaagtcaaccctgatcgacctgcttcagcgcttctacgacccggacgccggg
cgcatcctgctggacggcgtcgacctgcgcgaccttgacctggctgcgctgcgcaggcga
atcgccgtggtcagccaggacatcgtgttgttccgtggcaccctggcgcagaacctggct
tatggcgtgcccgaggccagccgtgatgaactggaacgggtggtgcgcctggcgcggctg
gacagcctggtcgacagcctgccgctgggcctggatggcttgctgggcgagcgcggccag
cagttgtccgggggccagaaacaacgcatcgccattgctcgtgcagtgttgcaggccccg
gcgatcctggtgctggacgaggccacttcggcagtggatgaggccaccgagcgtgaagtg
atcgcggccatcgaccagctgttcgccggccgcacgcgcatcctgatcagccaccgggct
tcgaccctggccgatgccgacctgcagctgcaactgcatgacggccagttgcaggtactg
gcgcaggaggtgatcaaacatgggcactga
DBGET
integrated database retrieval system