KEGG   Pseudomonas putida KT2440: PP_3466
Entry
PP_3466           CDS       T00114                                 
Name
(GenBank) putative ABC efflux transporter, permease/ATP-binding protein
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
ppu  Pseudomonas putida KT2440
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppu02000]
    PP_3466
Transporters [BR:ppu02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    PP_3466
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 AAA_29 ABC_membrane_3 AAA_22 SbcC_Walker_B RsgA_GTPase ABC_membrane_2 AAA_28 AAA_18 AAA_21
Other DBs
NCBI-ProteinID: AAN69068
UniProt: Q88H94
LinkDB
Position
complement(3931767..3933476)
AA seq 569 aa
MDSSDPVLMRQALAWLYGFVRPHRRAIGLLLSLSLGASLLALAQPWLVKTLIDEGLLAKD
YQTLWHMAAIMIGAGLLGTVLAGVNRYLHTRLSGRILFALRDDLYRHLQQLSPTFYGRRR
IGDILSRLDGDVAEIQRFAVDSLFSAVSAVIGLVGAVTLMLMLSWQLSLLLALLVPIEVL
WLRWMRRKVEREVRNLRERSADVSSFLVETLPAMKFIQAAGQQGREAGRLDQLGQGYMRQ
LLKVQVTEFFTQAIPGTLTSWCRACAFLVGGWWVIQGTWQLGALIAFSTYMGMAVGPVQS
LLGLYVAVQRMAVSLGRVMELKQEAVAVHQTANPQPIPDGPGELRLEALSFAHEGRQGAV
LNNVQVSIPGGLKVAISGASGVGKSTLIDLLQRFYDPDAGRILLDGVDLRDLDLAALRRR
IAVVSQDIVLFRGTLAQNLAYGVPEASRDELERVVRLARLDSLVDSLPLGLDGLLGERGQ
QLSGGQKQRIAIARAVLQAPAILVLDEATSAVDEATEREVIAAIDQLFAGRTRILISHRA
STLADADLQLQLHDGQLQVLAQEVIKHGH
NT seq 1710 nt   +upstreamnt  +downstreamnt
gtggattccagcgaccctgtactcatgcgccaggcgttggcctggctgtatggtttcgtg
cgcccccatcggcgtgccatcggcctgttgctcagcttgtcgctgggtgcatcgctgctg
gcgctggcgcaaccctggctggtcaagaccctgatcgatgaggggctgctggccaaggat
taccaaacgctttggcacatggcggcaatcatgatcggcgcgggcctgctgggcactgtg
ctggctggggtcaaccgctacctgcatacgcgcttgtcggggcgcatcctgtttgccctg
cgtgacgacctttaccgccatctgcagcaattgtcaccgaccttttacgggcggcggcgt
atcggcgacattctttcgcggctggatggcgatgtggcagagatccagcgctttgccgtg
gactcgctgttctcggcggtgtcggcggtgatcggcctggtgggcgcggtgacgttgatg
ctgatgctgtcgtggcagttgtcgctgttgctggcgctgctggtgccgatcgaagtgctg
tggctgcgctggatgcggcgcaaggtggagcgcgaagtgcgcaacttgcgtgagcgctcg
gcggatgtgtcgtctttcctggtcgagaccctgccggcgatgaagttcattcaggcggcc
ggccagcaaggccgggaagcagggcgcctggaccagcttgggcaaggttacatgcgtcag
ctgctgaaggtgcaggtgaccgaattcttcacccaggccatccccggcacgctcacctcg
tggtgccgcgcctgtgcgttcctggtcggtggctggtgggtgatccagggcacctggcaa
ctgggcgcgttgatcgctttttctacttacatgggcatggcggttgggccggtgcagagc
ctgttgggcttgtacgtggcggtgcagcgcatggctgtcagcctgggaagggtgatggaa
ttgaagcaggaagcggtagcagtacatcagaccgccaacccgcagcccatccccgatggc
cccggcgagttgcgcctggaggcgctgagctttgcccatgaggggcgtcagggtgcggta
ctgaacaacgtgcaggtgagcatcccgggtggcctgaaagtcgccatcagcggtgcctcc
ggggtgggcaagtcaaccctgatcgacctgcttcagcgcttctacgacccggacgccggg
cgcatcctgctggacggcgtcgacctgcgcgaccttgacctggctgcgctgcgcaggcga
atcgccgtggtcagccaggacatcgtgttgttccgtggcaccctggcgcagaacctggct
tatggcgtgcccgaggccagccgtgatgaactggaacgggtggtgcgcctggcgcggctg
gacagcctggtcgacagcctgccgctgggcctggatggcttgctgggcgagcgcggccag
cagttgtccgggggccagaaacaacgcatcgccattgctcgtgcagtgttgcaggccccg
gcgatcctggtgctggacgaggccacttcggcagtggatgaggccaccgagcgtgaagtg
atcgcggccatcgaccagctgttcgccggccgcacgcgcatcctgatcagccaccgggct
tcgaccctggccgatgccgacctgcagctgcaactgcatgacggccagttgcaggtactg
gcgcaggaggtgatcaaacatgggcactga

DBGET integrated database retrieval system