Pseudomonas putida DLL-E4: DW66_2403
Help
Entry
DW66_2403 CDS
T03439
Name
(GenBank) oxidoreductase domain-containing protein
Organism
ppud
Pseudomonas putida DLL-E4
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
GFO_IDH_MocA
GFO_IDH_MocA_C3
GFO_IDH_MocA_C
CoA_binding
Gal80p_C-like
F420_oxidored
DapB_N
NAD_binding_3
Shikimate_DH
Bac_export_2
Motif
Other DBs
NCBI-ProteinID:
AHZ76915
LinkDB
All DBs
Position
2629703..2630755
Genome browser
AA seq
350 aa
AA seq
DB search
MNAPLRIALIGAGSMGRQHYQHLLNVPQAQLCAVADPGPQAEAFAAECGVPCFADHRQML
EHARPEAVIVANPNNLHVATALDCVEAGVPVLVEKPVGVHLDEVRALVEASRRHDVPVLV
GHHRRHNPLIAKAHQVIADGKLGRLINVTALWQLQKPDSYFDTPWRREPGAGFLLTNLIH
DLDLLRHLCGEVVQVQAFTRNDVRGFANEDSAAVLLQFANGALGSLTGSDAVAAPWSWEL
DSGESPVYPRQDGQPCYLLAGTQGALSIPQLKRWHYAEAGSGWHTPLLQSEESIPAGEAL
TLQLQHFVRVARGEQAPLIDAADGGRTLALIEAIRQAAETGRACVPEHIA
NT seq
1053 nt
NT seq
+upstream
nt +downstream
nt
ttgaacgcaccccttcgtattgccttgatcggcgccggcagcatgggccgccagcattac
cagcatttgctgaatgtgccgcaggcccagctgtgcgctgtggccgacccgggcccgcag
gccgaggcctttgccgccgaatgcggcgtgccctgttttgccgaccaccgccagatgctg
gagcacgcgcgccccgaggcagtgatcgtcgccaacccgaacaacctgcatgtcgccacc
gccctggactgcgtcgaggccggtgtaccggtgctggtcgaaaaaccggtgggcgtgcac
ctggatgaagtccgcgcgctggtggaagcctcgcgccgccacgatgtgccggtgctggtc
ggccatcatcgccggcacaacccgctgatcgccaaggctcaccaggtgattgccgacggc
aagctgggccgattgatcaacgtcaccgcgctgtggcagttgcaaaagcccgacagctat
ttcgacaccccctggcgccgcgagccgggcgctggcttcctgctgaccaacctgatccat
gacctcgacctgctgcgccacctgtgcggcgaggtggtacaggtgcaggcattcacccgc
aacgatgtgcgcggttttgccaacgaggacagcgccgcggtgctactgcagttcgccaat
ggagcattgggcagcctgactggctccgacgcggtggccgcgccgtggagctgggagctg
gactccggcgaaagcccggtctacccgcgccaggatggccagccgtgctacctcctggcc
ggcacccagggggcgctgagcattccgcaactcaagcgctggcactacgccgaggccggg
tcgggctggcacacgccgttgttgcagagcgaggaaagcatccccgccggcgaggcattg
accttgcagttgcaacacttcgtacgggttgcccggggtgaacaggcgccgctgatcgat
gccgccgatggtggccgtaccctggcgctgatcgaggcgatccgccaggcagcggaaact
ggccgggcctgtgtgcccgagcacattgcttga
DBGET
integrated database retrieval system