KEGG   Pseudomonas putida DLL-E4: DW66_5031
Entry
DW66_5031         CDS       T03439                                 
Name
(GenBank) peptidase U61 LD-carboxypeptidase A
  KO
K01297  muramoyltetrapeptide carboxypeptidase [EC:3.4.17.13]
Organism
ppud  Pseudomonas putida DLL-E4
Brite
KEGG Orthology (KO) [BR:ppud00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ppud01002]
    DW66_5031
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppud01011]
    DW66_5031
Enzymes [BR:ppud01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.13  muramoyltetrapeptide carboxypeptidase
     DW66_5031
Peptidases and inhibitors [BR:ppud01002]
 Serine peptidases
  Family S66
   DW66_5031
Peptidoglycan biosynthesis and degradation proteins [BR:ppud01011]
 Precursor biosynthesis
  Carboxypeptidase
   DW66_5031
SSDB
Motif
Pfam: Peptidase_S66 Peptidase_S66C
Other DBs
NCBI-ProteinID: AHZ79528
LinkDB
Position
complement(5534673..5535611)
AA seq 312 aa
MNCAETFQPSLPAALPRDACFAIVAPAGAARLDTHKVNQWFVDRGYSCRIYPGALQAQGY
LAGPDRQRLQDLHDAFADPAIDAILCMRGGYGSMRLLDQLDFELIRCNPKPLIGYSDITA
LHTAIYRHTGLLTFHGGMLNADLLGAKLPPTETSLLAQLGGHVRAGEQIVHPADFALSSV
LHGVASGPLLGGNLSMLGATLGTIAELDTQGCILFIEDVNEPLYRVDRLLTQLRLAGKLE
GVKGVLVGDFAGITTAALTPLLEDIFAPLGVPVLAGWRSGHCDPNVCLPLGAQVMLDSGR
QTLVLEQDLFKA
NT seq 939 nt   +upstreamnt  +downstreamnt
atgaattgcgccgaaaccttccaacccagcctgccagccgcgctgccgcgtgatgcctgt
tttgccattgtcgccccggcgggcgcggcgcggctggatacgcacaaggtcaaccagtgg
ttcgttgatagaggctacagctgccgcatctatccgggagcccttcaggcccagggctat
ctggcggggccggaccggcagcggttacaggacctgcatgatgcctttgccgacccggct
atcgacgccattctgtgcatgcgtggggggtacggtagcatgcggctgctcgaccaactc
gatttcgaactgatccggtgcaaccccaagccgctgatcggttacagcgacataaccgcg
ctgcacacggcgatctaccggcataccgggctgctcacctttcatggcgggatgctcaat
gccgacctgctgggggccaagttgccgccaaccgagacttcgttgctggcgcagctgggt
gggcatgtgcgggcaggggagcagatcgtgcaccctgctgacttcgcattgagcagcgtg
ctgcatggggtggccagcgggccgctgctgggcggcaacctgtcgatgttgggcgcgacc
ctggggacgattgccgaactggatacgcagggctgcatcctgttcatcgaggacgtcaac
gagccgctttaccgggtggatcgcttgctgacccagctgcgcctggcaggcaagctggag
ggggtgaagggtgtgctggtgggggactttgccgggattaccactgcggcgttgacgcct
ctgctggaggatatcttcgcgccgctgggtgtaccggtgctggccgggtggcgcagtggg
cattgtgacccgaatgtgtgcttgccgttgggggctcaggtaatgctggatagcgggagg
cagacattggtgttggagcaggatttgttcaaggcttga

DBGET integrated database retrieval system