Pseudomonas putida DLL-E4: DW66_5031
Help
Entry
DW66_5031 CDS
T03439
Name
(GenBank) peptidase U61 LD-carboxypeptidase A
KO
K01297
muramoyltetrapeptide carboxypeptidase [EC:
3.4.17.13
]
Organism
ppud
Pseudomonas putida DLL-E4
Brite
KEGG Orthology (KO) [BR:
ppud00001
]
09180 Brite Hierarchies
09181 Protein families: metabolism
01002 Peptidases and inhibitors [BR:
ppud01002
]
DW66_5031
01011 Peptidoglycan biosynthesis and degradation proteins [BR:
ppud01011
]
DW66_5031
Enzymes [BR:
ppud01000
]
3. Hydrolases
3.4 Acting on peptide bonds (peptidases)
3.4.17 Metallocarboxypeptidases
3.4.17.13 muramoyltetrapeptide carboxypeptidase
DW66_5031
Peptidases and inhibitors [BR:
ppud01002
]
Serine peptidases
Family S66
DW66_5031
Peptidoglycan biosynthesis and degradation proteins [BR:
ppud01011
]
Precursor biosynthesis
Carboxypeptidase
DW66_5031
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Peptidase_S66
Peptidase_S66C
Motif
Other DBs
NCBI-ProteinID:
AHZ79528
LinkDB
All DBs
Position
complement(5534673..5535611)
Genome browser
AA seq
312 aa
AA seq
DB search
MNCAETFQPSLPAALPRDACFAIVAPAGAARLDTHKVNQWFVDRGYSCRIYPGALQAQGY
LAGPDRQRLQDLHDAFADPAIDAILCMRGGYGSMRLLDQLDFELIRCNPKPLIGYSDITA
LHTAIYRHTGLLTFHGGMLNADLLGAKLPPTETSLLAQLGGHVRAGEQIVHPADFALSSV
LHGVASGPLLGGNLSMLGATLGTIAELDTQGCILFIEDVNEPLYRVDRLLTQLRLAGKLE
GVKGVLVGDFAGITTAALTPLLEDIFAPLGVPVLAGWRSGHCDPNVCLPLGAQVMLDSGR
QTLVLEQDLFKA
NT seq
939 nt
NT seq
+upstream
nt +downstream
nt
atgaattgcgccgaaaccttccaacccagcctgccagccgcgctgccgcgtgatgcctgt
tttgccattgtcgccccggcgggcgcggcgcggctggatacgcacaaggtcaaccagtgg
ttcgttgatagaggctacagctgccgcatctatccgggagcccttcaggcccagggctat
ctggcggggccggaccggcagcggttacaggacctgcatgatgcctttgccgacccggct
atcgacgccattctgtgcatgcgtggggggtacggtagcatgcggctgctcgaccaactc
gatttcgaactgatccggtgcaaccccaagccgctgatcggttacagcgacataaccgcg
ctgcacacggcgatctaccggcataccgggctgctcacctttcatggcgggatgctcaat
gccgacctgctgggggccaagttgccgccaaccgagacttcgttgctggcgcagctgggt
gggcatgtgcgggcaggggagcagatcgtgcaccctgctgacttcgcattgagcagcgtg
ctgcatggggtggccagcgggccgctgctgggcggcaacctgtcgatgttgggcgcgacc
ctggggacgattgccgaactggatacgcagggctgcatcctgttcatcgaggacgtcaac
gagccgctttaccgggtggatcgcttgctgacccagctgcgcctggcaggcaagctggag
ggggtgaagggtgtgctggtgggggactttgccgggattaccactgcggcgttgacgcct
ctgctggaggatatcttcgcgccgctgggtgtaccggtgctggccgggtggcgcagtggg
cattgtgacccgaatgtgtgcttgccgttgggggctcaggtaatgctggatagcgggagg
cagacattggtgttggagcaggatttgttcaaggcttga
DBGET
integrated database retrieval system