Pandoraea pulmonicola: RO07_04180 Help Entry RO07_04180        CDS       T03553                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppul  Pandoraea pulmonicola Pathway ppul00998   Biosynthesis of various antibiotics ppul01100   Metabolic pathways ppul01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppul00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RO07_04180    00074 Mycolic acid biosynthesis     RO07_04180   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RO07_04180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH DUF1896 DUF1493 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AJC19877 UniProt:  A0AAJ5D1V7 LinkDB All DBs Position complement(4905968..4906210) Genome browser AA seq 80 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNESSFVNDLGADSLDTVELVMALEEEFTTEIPDEAA EKITTVQQAIDYIKAHQAAA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggataacattgagcaacgcgtcaagaagatcgtcgcggaacaacttggcgttgccgag gccgaaatcaagaacgaatccagcttcgtgaacgatctgggcgccgattcgctcgatacg gttgaactggtgatggccctggaagaagagttcaccacggaaatcccggacgaagccgcc gagaagatcactaccgtgcaacaagccatcgattacatcaaggcccatcaggcggcagcc taa

DBGET integrated database retrieval system