Pandoraea pulmonicola: RO07_10925 Help Entry RO07_10925        CDS       T03553                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism ppul  Pandoraea pulmonicola Brite KEGG Orthology (KO) [BR:ppul00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ppul03110]     RO07_10925 Chaperones and folding catalysts [BR:ppul03110]  Protein folding catalysts   Protein disulfide isomerase    RO07_10925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  AJC20860 UniProt:  A0AAJ4ZC18 LinkDB All DBs Position 559781..560041 Genome browser AA seq 86 aa AA seqDB search MPKIVMYSTQVCPYCQMAERLLRRRGVQDIEKILIDREPGRREEMMKRTGRRTVPQIYID ERHIGGYDDLSALDRAGGLVPLLQAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcccaagatcgtgatgtacagcacgcaagtgtgcccgtactgccagatggccgaacgt ctgctgcgtcggcgcggcgttcaggacatcgagaagatcctcatcgacagggagccgggc cgccgcgaagaaatgatgaagcgcacggggcgccgcacggtgccgcagatctacatcgac gagcgccatatcggtggctacgacgacctgtcggccctcgatcgggcgggcggtctcgtg ccgctcttgcaagctgcctga

DBGET integrated database retrieval system