Pandoraea pulmonicola: RO07_11065 Help Entry RO07_11065        CDS       T03553                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism ppul  Pandoraea pulmonicola Pathway ppul00190   Oxidative phosphorylation ppul01100   Metabolic pathways ppul02020   Two-component system Module ppul_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ppul00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     RO07_11065  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     RO07_11065 Enzymes [BR:ppul01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      RO07_11065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB 2TM Motif Other DBs NCBI-ProteinID:  AJC20880 UniProt:  A0AAJ4ZBW0 LinkDB All DBs Position complement(585508..585624) Genome browser AA seq 38 aa AA seqDB search MWYFSWILGLGLALAFGIINVMWFEAHDDLERRSQEDN NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttctcttggattctcggcctcggcctcgcgctcgcgttcggcatcatcaac gtgatgtggttcgaagcgcatgacgacctcgaacgtcgcagccaggaagacaactga

DBGET integrated database retrieval system