Pandoraea pulmonicola: RO07_13360 Help Entry RO07_13360        CDS       T03553                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism ppul  Pandoraea pulmonicola Pathway ppul02020   Two-component system ppul02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:ppul00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     RO07_13360  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     RO07_13360  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:ppul02035]     RO07_13360 Bacterial motility proteins [BR:ppul02035]  Flagellar system   Flagellar assembly proteins    Others     RO07_13360 SSDB OrthologParalogGFIT Motif Pfam:  FlgM Rsa3 ParD_antitoxin Motif Other DBs NCBI-ProteinID:  AJC23319 UniProt:  A0AAJ5CZX3 LinkDB All DBs Position 1091889..1092185 Genome browser AA seq 98 aa AA seqDB search MKLVGTRPASEVRRSDDKQKRTRERGAIAEAPVRGGADTPLATHVVQPAMAALRDMPDFD EARVAALREALKAGELPFDAGKLACLIQRFHGTRGRER NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaaattggtaggcacccggcccgcaagcgaagtccggcggagcgatgacaagcaaaag cgcacgcgagagcggggcgcgatagccgaagctcccgttcgaggcggagccgatacccct ttggcaacgcacgtcgtacaacccgccatggcggcactgcgcgacatgccggatttcgac gaggcgcgagtcgcagccctgcgcgaggcgctcaaggcgggtgagcttccgttcgacgcg ggcaagctggcatgtttgattcagcgctttcacggtacgcgtgggagagagcgatga

DBGET integrated database retrieval system