Pandoraea pulmonicola: RO07_14430 Help Entry RO07_14430        CDS       T03553                                  Name (GenBank) hypothetical protein   KO K02408   flagellar hook-basal body complex protein FliE Organism ppul  Pandoraea pulmonicola Pathway ppul02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:ppul00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     RO07_14430  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:ppul02035]     RO07_14430 Bacterial motility proteins [BR:ppul02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     RO07_14430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FliE Motif Other DBs NCBI-ProteinID:  AJC23345 LinkDB All DBs Position 1331690..1331995 Genome browser AA seq 101 aa AA seqDB search MTELDRMHATQRELGRAAGASESDLAHVGTLNKPDFGAMLRGVDAAQREAGERMTAVDLG HSDDLTGAMLASAQAELSFSMLMKTRDKVVGAVEELVRMPF NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaccgagctggatcgcatgcacgcgacgcagcgcgaactgggccgggcggccggtgcg agcgagtccgatctcgcgcacgtcggcacgctgaacaaacccgacttcggcgcgatgctg cgtggtgtggacgccgcgcagcgcgaagcgggcgagcgcatgacggcggtcgatctggga cacagcgacgatctgacgggcgccatgctggcgagcgcgcaggccgaactgtcgttctcg atgctgatgaagacgcgcgacaaggtcgtgggcgccgtcgaggaactggtgcgcatgccg ttctga

DBGET integrated database retrieval system