Pandoraea pulmonicola: RO07_20220 Help Entry RO07_20220        CDS       T03553                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ppul  Pandoraea pulmonicola Brite KEGG Orthology (KO) [BR:ppul00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ppul03032]     RO07_20220    03036 Chromosome and associated proteins [BR:ppul03036]     RO07_20220    03400 DNA repair and recombination proteins [BR:ppul03400]     RO07_20220 DNA replication proteins [BR:ppul03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     RO07_20220 Chromosome and associated proteins [BR:ppul03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     RO07_20220 DNA repair and recombination proteins [BR:ppul03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       RO07_20220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 Motif Other DBs NCBI-ProteinID:  AJC22239 UniProt:  A0AAJ4Z8H3 LinkDB All DBs Position complement(2687829..2688107) Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAGATGASKANTGETIDAVLEVIKKAVAKGDAVQLIGFGSFGSGKRAARTG RNPKTGEAIKIPAAKTVKFTAGKAFKDAVNKK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgccgtcgccggcgctacgggcgcatccaaagcaaac actggcgaaaccatcgacgctgtgctcgaggtcatcaagaaggctgtcgccaagggtgat gcggttcagttgatcggctttggctcgttcggttcgggcaagcgtgctgcgcgtaccggc cgcaacccgaagaccggcgaagcgatcaagatccccgcagccaagaccgtgaagttcacg gctggcaaggcgttcaaggacgccgtcaacaagaagtaa

DBGET integrated database retrieval system