Pandoraea pulmonicola: RO07_21075 Help Entry RO07_21075        CDS       T03553                                  Name (GenBank) H-NS histone   KO K03746   DNA-binding protein H-NS Organism ppul  Pandoraea pulmonicola Brite KEGG Orthology (KO) [BR:ppul00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppul03036]     RO07_21075    03400 DNA repair and recombination proteins [BR:ppul03400]     RO07_21075 Chromosome and associated proteins [BR:ppul03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     RO07_21075 DNA repair and recombination proteins [BR:ppul03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       RO07_21075 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_HNS DUF8126 DUF5660 DUF3810 Motif Other DBs NCBI-ProteinID:  AJC22357 UniProt:  A0AAJ4ZHM1 LinkDB All DBs Position complement(2930250..2930540) Genome browser AA seq 96 aa AA seqDB search MATYHELREQAEELARRAEQMRRELKQAVIEDIRAKVAEYGITAQEIFERHKRPKPSVPV RPKYRDASTGATWTGRGMEPRWIRGKDRRQFLIDQE NT seq 291 nt NT seq  +upstreamnt  +downstreamnt ttggcgacttaccacgaactaagggaacaagccgaagaactcgcccgccgcgctgaacaa atgcggcgcgagttgaagcaggcggtcatcgaggacattcgtgccaaggtggctgagtac gggatcacggcacaggagattttcgagcggcacaagcgcccgaaaccctcggtgccggtc cggcccaagtatcgggatgcgtcgacgggcgcaacctggaccggacgcggtatggagccg cgctggatcaggggaaaggaccggcggcagttcctgattgaccaggaatga

DBGET integrated database retrieval system