Pseudomonas putida NBRC 14164: PP4_08710 Help Entry PP4_08710         CDS       T02707                                  Symbol groS Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism ppun  Pseudomonas putida NBRC 14164 Brite KEGG Orthology (KO) [BR:ppun00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ppun03110]     PP4_08710 (groS)    03029 Mitochondrial biogenesis [BR:ppun03029]     PP4_08710 (groS) Chaperones and folding catalysts [BR:ppun03110]  Heat shock proteins   HSP10    PP4_08710 (groS) Mitochondrial biogenesis [BR:ppun03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     PP4_08710 (groS) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  BAN52724 UniProt:  A0ABM7EAM2 LinkDB All DBs Position 1003180..1003473 Genome browser AA seq 97 aa AA seqDB search MKLRPLHDRVVIRRSEEESKTAGGIVLPGSAAEKPNRGEVVAVGTGRILDNGEVRALAVK VGDKVVFGPYSGSNTVKVDGEDLLVMAENEILAVVEG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaagcttcgtcctctgcatgaccgcgtagtcatccgtcgcagcgaagaagaatcgaaa accgctggcggtatcgtcctgccgggttcggccgctgaaaaaccaaaccgcggcgaagtt gttgccgtcggcaccggtcgcatcctggacaacggcgaagttcgcgcgctggccgtgaaa gtgggtgacaaagtggtattcggcccttactcgggcagcaacaccgtgaaagtcgatggc gaagacctgctggtcatggccgagaacgaaatcctcgccgttgtcgaaggctga

DBGET integrated database retrieval system