KEGG   Pogoniulus pusillus (red-fronted tinkerbird): 135177450
Entry
135177450         CDS       T10504                                 
Symbol
AK4
Name
(RefSeq) adenylate kinase 4, mitochondrial
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
ppus  Pogoniulus pusillus (red-fronted tinkerbird)
Pathway
ppus00230  Purine metabolism
ppus00730  Thiamine metabolism
ppus01100  Metabolic pathways
ppus01232  Nucleotide metabolism
ppus01240  Biosynthesis of cofactors
Module
ppus_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:ppus00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    135177450 (AK4)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    135177450 (AK4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppus04147]
    135177450 (AK4)
Enzymes [BR:ppus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     135177450 (AK4)
Exosome [BR:ppus04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   135177450 (AK4)
SSDB
Motif
Pfam: ADK AAA_17 ADK_lid AAA_18 Cytidylate_kin AAA_33 AAA_16 NTPase_1 AAA_28 AAA AAA_22
Other DBs
NCBI-GeneID: 135177450
NCBI-ProteinID: XP_064003495
LinkDB
Position
8:17941331..17956666
AA seq 223 aa
MASKLLRAVVLGPPGSGKGTVCERIARSFGLQHLSSGQFLRENLRGGGEVGALAKQYLGR
GLLVPDHVITRLMMTELEKRREQHWLLDGFPRTLGQAEALDRICELDLVISLNIPFETLK
DRLSARWVHPASGRVYNMDFNPPHVQGVDDLTGEPLVQSEDDRPEAVAARLRKYKDAAKP
VMELYKSRGILHSFSGTETNKIWPYVYTLLSSKIPPVLSDEEN
NT seq 672 nt   +upstreamnt  +downstreamnt
atggcctccaaactgctgcgggcggtggtgctgggaccccccggctcggggaaggggacg
gtgtgcgagaggatcgcccgtagttttgggctccagcatctttccagcggtcaattcctg
cgggagaatctccgcgggggcggcgaagttggcgccctggcgaagcagtaccttgggcga
ggcctgctggtgccagaccatgtcatcacccgcctgatgatgacggagctggagaagcgg
cgagagcagcactggctgctggatggtttccctcggactctggggcaagcggaggcactg
gacaggatctgtgaactggacctggtgatcagcttgaacatcccctttgagacgctgaag
gatcgcctgagcgcccgctgggtccaccctgctagtgggagggtctacaacatggacttc
aacccaccacacgtccagggcgtggacgacctgacgggtgagccgctggtgcagagcgag
gacgacagacccgaagctgtggctgcccggctcaggaagtacaaagatgctgcaaagcca
gtgatggagctgtacaagagcaggggcatccttcactccttctcagggacagagaccaac
aagatctggccgtacgtgtacactctgctttccagcaagatcccaccagtcctctcagat
gaggagaactaa

DBGET integrated database retrieval system