Pseudomonas putida H8234: L483_07095 Help Entry L483_07095        CDS       T02706                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pput  Pseudomonas putida H8234 Pathway pput01100   Metabolic pathways pput01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pput00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     L483_07095 (acpP)    00074 Mycolic acid biosynthesis     L483_07095 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     L483_07095 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Ribosomal_L50 Fas_alpha_ACP Motif Other DBs NCBI-ProteinID:  AGN78323 LinkDB All DBs Position 1537665..1537901 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNEKSFVDDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVNSHKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgccgagcaactgggcgtgaaggaa gaggaagtgactaacgagaagtccttcgtcgatgacctgggtgccgattcgcttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagcc gagaaaatcactaccgttcaagccgctatcgactacgttaacagccacaaggcctaa

DBGET integrated database retrieval system