Pseudomonas putida H8234: L483_24320 Help Entry L483_24320        CDS       T02706                                  Name (GenBank) anti-sigma-28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism pput  Pseudomonas putida H8234 Pathway pput02020   Two-component system pput02025   Biofilm formation - Pseudomonas aeruginosa pput02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pput00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     L483_24320  09140 Cellular Processes   09145 Cellular community - prokaryotes    02025 Biofilm formation - Pseudomonas aeruginosa     L483_24320   09142 Cell motility    02040 Flagellar assembly     L483_24320  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pput02035]     L483_24320 Bacterial motility proteins [BR:pput02035]  Flagellar system   Flagellar assembly proteins    Others     L483_24320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  AGN80005 LinkDB All DBs Position 5148720..5149034 Genome browser AA seq 104 aa AA seqDB search MVIDFSRLNNSPSVTGGVRGNTAAGNAEKPAASQEAVKDTSASGEAVHLSQEAQQLQKVS DKLRDEPVVNSARVAQLKQAIADGSYQVDAGRVASKLLDFEAQR NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggtcatcgacttcagtcgtttgaataactctccgtccgtcacgggcggcgtgcgcggc aacaccgcggcgggcaatgccgaaaaaccggcagccagccaggaagcggtgaaagacacc agcgccagcggagaagcggtacacctcagccaagaggcacagcagttgcaaaaggtcagc gacaagctgcgcgacgagccggttgtcaacagtgcccgtgtggcccagttgaaacaggcg atcgccgacggcagctaccaggtcgatgccggccgggtcgccagcaaactgctcgatttc gaagcccagcgctga

DBGET integrated database retrieval system