Pseudomonas sp. UW4: PputUW4_00375 Help Entry PputUW4_00375     CDS       T02357                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppuu  Pseudomonas sp. UW4 Pathway ppuu01100   Metabolic pathways ppuu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppuu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PputUW4_00375    00074 Mycolic acid biosynthesis     PputUW4_00375   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PputUW4_00375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AFY17583 LinkDB All DBs Position complement(419680..419955) Genome browser AA seq 91 aa AA seqDB search MSDRNTHSLVLEIKELIIEALGLEDISAEDIGNEQTLFGEGLGLDSVDALELGLAIQKKY GIKIDADAKDTRNHFSNVASLAAFVTAKQAA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagcgatcggaacacccatagcctggtgctggaaatcaaagagctgatcatcgaagcc ctgggcctcgaggacatcagcgccgaagacatcggcaacgagcagacactgttcggcgaa ggcttgggcctggactcggtggacgccctggaactgggcctggccatccagaaaaagtac ggcatcaaaatcgatgccgatgccaaagacacccgtaaccacttcagtaacgtggcgagc cttgcggcgttcgtcactgcaaaacaggcagcttga

DBGET integrated database retrieval system