Pseudomonas sp. UW4: PputUW4_03620 Help Entry PputUW4_03620     CDS       T02357                                  Symbol iacP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppuu  Pseudomonas sp. UW4 Pathway ppuu01100   Metabolic pathways ppuu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppuu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PputUW4_03620 (iacP)    00074 Mycolic acid biosynthesis     PputUW4_03620 (iacP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PputUW4_03620 (iacP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 RE_HaeII Motif Other DBs NCBI-ProteinID:  AFY20812 LinkDB All DBs Position complement(4207184..4207462) Genome browser AA seq 92 aa AA seqDB search MSDESSDKFDIASQVIKVLSDYFPAGRRGIELTSRLVQDLYVDSISLIEIVMALNETFGI DLPEDRVGLWRTVEDVCESVMSSRSCRASDLE NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgtcagatgagtcaagtgataagttcgacatcgcgagtcaagtaatcaaggttttgtcg gactattttccggcgggtcgtcgaggcatcgagttgacttcgcgattggtccaggatttg tatgttgactccatcagtctgattgagattgtcatggcgctgaatgaaaccttcggtatt gaccttcctgaagatagagtcgggttgtggaggacggtagaagatgtttgtgaatcagtg atgagttcaagaagttgccgggcgtcagatttggagtga

DBGET integrated database retrieval system