Pseudomonas sp. UW4: PputUW4_04032 Help Entry PputUW4_04032     CDS       T02357                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppuu  Pseudomonas sp. UW4 Pathway ppuu01100   Metabolic pathways ppuu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppuu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PputUW4_04032 (acpP)    00074 Mycolic acid biosynthesis     PputUW4_04032 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PputUW4_04032 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  AFY21224 LinkDB All DBs Position complement(4644079..4644315) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgctgagcaactgggcgttaaagaa gaagaagtggtcaacactgcttccttcgttgaagacctgggtgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagcc gagaagatcactactgtacaagctgcaatcgactacgttactagccaccaggcgtaa

DBGET integrated database retrieval system