Pseudomonas sp. UW4: PputUW4_04868
Help
Entry
PputUW4_04868 CDS
T02357
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
ppuu
Pseudomonas sp. UW4
Pathway
ppuu03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
ppuu00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
PputUW4_04868 (rplR)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
ppuu03011
]
PputUW4_04868 (rplR)
Ribosome [BR:
ppuu03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
PputUW4_04868 (rplR)
Bacteria
PputUW4_04868 (rplR)
Archaea
PputUW4_04868 (rplR)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
TGS
Motif
Other DBs
NCBI-ProteinID:
AFY22058
LinkDB
All DBs
Position
complement(5563305..5563655)
Genome browser
AA seq
116 aa
AA seq
DB search
MTDKKVTRLRRARKARLKMHELEVVRLCVFRSSQHIYAQVISADGNKVLASASTLDKELR
DGATGNIDAATKVGQLVATRAKAAGVSQVAFDRSGFKYHGRVKALADAAREAGLEF
NT seq
351 nt
NT seq
+upstream
nt +downstream
nt
atgaccgacaaaaaagttactcgactgcgtcgcgctcgcaaagcacgcctgaaaatgcac
gaactcgaagtcgtgcgtctctgcgtgttccgctcttcgcagcacatctacgcccaggtc
atttcggccgacggcaacaaagtcctggcaagcgcctcgactttggataaagaactgcgt
gatggtgccaccggcaacatcgacgcggccactaaggttggccagctggtcgctacgcgt
gctaaggccgctggcgtctcgcaggtggctttcgaccgctctggcttcaagtaccacggc
cgcgttaaagcgctggctgatgctgctcgtgaagctgggctggagttctaa
DBGET
integrated database retrieval system