Pseudomonas sp. UW4: PputUW4_05237 Help Entry PputUW4_05237     CDS       T02357                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism ppuu  Pseudomonas sp. UW4 Brite KEGG Orthology (KO) [BR:ppuu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppuu03036]     PputUW4_05237 Chromosome and associated proteins [BR:ppuu03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PputUW4_05237 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asd-4 TPR_MLP1_2 ZapB VGPC1_C Macoilin Motif Other DBs NCBI-ProteinID:  AFY22426 LinkDB All DBs Position 5967454..5967663 Genome browser AA seq 69 aa AA seqDB search MEDTDLQALMARLELLITRVEQLKSQNGLLLAQEKTWREERAHLIEKNEIARRKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaccgacctgcaagcgctgatggccagactcgaattgctgattacccgagtc gagcaacttaagagtcaaaacggactcttactagctcaggaaaagacctggcgcgaggaa cgcgcgcatctcattgaaaaaaacgaaatcgcccggcgtaaggtcgagtcgatgatttcg cgcctcaaggccctggagcaagactcatga

DBGET integrated database retrieval system