Pseudomonas parafulva: NJ69_03320 Help Entry NJ69_03320        CDS       T03520                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppv  Pseudomonas parafulva Pathway ppv01100   Metabolic pathways ppv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NJ69_03320    00074 Mycolic acid biosynthesis     NJ69_03320   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NJ69_03320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L50 HTH_33 dATP-dGTP_PPHyd Motif Other DBs NCBI-ProteinID:  AIZ32118 UniProt:  A0AAI8K9M1 LinkDB All DBs Position 747775..748005 Genome browser AA seq 76 aa AA seqDB search MTVSNEAIAQAISARFNIEESRILPEASLEDLGFDSLSQVDLAQLLRKKLGVQISDAQLS DVATVGDVLALVNGKA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgaccgttagcaatgaagcaatcgcccaggctatctccgcacgtttcaacatcgaggaa agccgtatcctgcccgaagcctccctagaggacctgggcttcgactcactgtctcaggtc gaccttgcgcagttgctgcgcaagaagctgggtgtgcagatcagcgatgcccagctgtcg gacgtcgccacggtgggtgacgtcctggcgctggtcaacggtaaagcgtga

DBGET integrated database retrieval system