Pseudomonas putida W619: PputW619_1526 Help Entry PputW619_1526     CDS       T00675                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppw  Pseudomonas putida W619 Pathway ppw01100   Metabolic pathways ppw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PputW619_1526    00074 Mycolic acid biosynthesis     PputW619_1526   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PputW619_1526 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Fas_alpha_ACP Ribosomal_L50 DUF1493 HLH Motif Other DBs NCBI-ProteinID:  ACA72031 UniProt:  B1J4Z1 LinkDB All DBs Position 1683074..1683310 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEDEVTNEKSFVDDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVNSHQG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgccgagcaactgggcgtgaaggaa gatgaagtgaccaacgagaagtcctttgtcgatgacctgggtgccgattcgcttgacacc gttgagctggtgatggctctggaagaggaattcgagactgaaatccctgacgaagaagcc gagaagatcactaccgttcaagctgccatcgactacgtcaactcccaccagggttaa

DBGET integrated database retrieval system