Pseudomonas putida W619: PputW619_5027 Help Entry PputW619_5027     CDS       T00675                                  Name (GenBank) conserved hypothetical protein   KO K09892   cell division protein ZapB Organism ppw  Pseudomonas putida W619 Brite KEGG Orthology (KO) [BR:ppw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppw03036]     PputW619_5027 Chromosome and associated proteins [BR:ppw03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PputW619_5027 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Filament ADIP ZapB TPR_MLP1_2 HALZ RRP7 Motif Other DBs NCBI-ProteinID:  ACA75503 UniProt:  B1JEZ2 LinkDB All DBs Position 5554894..5555112 Genome browser AA seq 72 aa AA seqDB search MQPTQENDLQALMSRFESLIERVEQLKRQNALLVAQEKSWREERAHLIEKNEIAKRKVES MILRLKALEQDS NT seq 219 nt NT seq  +upstreamnt  +downstreamnt gtgcaacccacgcaagagaacgacctgcaagcattgatgagccggttcgagtcgctgatc gagcgcgtcgagcaacttaaacggcaaaatgcactcctagtagctcaggaaaaatcctgg cgcgaagagcgcgcccacctcatcgaaaagaacgagatcgccaagcgcaaggtcgagtcg atgatcttacgcctcaaggccctggagcaagactcatga

DBGET integrated database retrieval system