Pseudomonas putida DOT-T1E: T1E_3699 Help Entry T1E_3699          CDS       T02181                                  Name (GenBank) DNA-binding protein Fis   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism ppx  Pseudomonas putida DOT-T1E Brite KEGG Orthology (KO) [BR:ppx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ppx03000]     T1E_3699    03036 Chromosome and associated proteins [BR:ppx03036]     T1E_3699    03400 DNA repair and recombination proteins [BR:ppx03400]     T1E_3699 Transcription factors [BR:ppx03000]  Prokaryotic type   Helix-turn-helix    Other families     T1E_3699 Chromosome and associated proteins [BR:ppx03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     T1E_3699 DNA repair and recombination proteins [BR:ppx03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       T1E_3699 SSDB OrthologParalogGFIT Motif Pfam:  Fis_N HTH_8 Motif Other DBs NCBI-ProteinID:  AFO49532 LinkDB All DBs Position 4058345..4058623 Genome browser AA seq 92 aa AA seqDB search MSDNANLKQHLNTPSEEGQTLRDSVEKALHNYFAHLEGATVTDVYNLVLSEVEAPLLESV MNYVKGNQTKASEMLGLNRGTLRKKLKQYDLL NT seq 279 nt NT seq  +upstreamnt  +downstreamnt gtgagcgacaacgccaacctgaaacagcacctcaacacgccgagcgaagagggccagacc cttcgcgacagcgtcgagaaggcgctgcacaactacttcgcccacctggaaggcgcgacc gtgacggacgtgtacaacctggtgctctccgaagtcgaggcgcccctgctcgaaagcgtg atgaactacgtgaagggcaaccagaccaaggccagcgagatgctcgggctgaaccgaggc accctgcgcaagaagctcaagcagtacgacttgttgtaa

DBGET integrated database retrieval system