KEGG   Pseudomonas putida DOT-T1E: T1E_4241
Entry
T1E_4241          CDS       T02181                                 
Name
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K10617  p-cumic alcohol dehydrogenase
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00622  Xylene degradation
ppx01100  Metabolic pathways
ppx01120  Microbial metabolism in diverse environments
ppx01220  Degradation of aromatic compounds
Module
ppx_M00419  Cymene degradation, p-cymene => p-cumate
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00622 Xylene degradation
    T1E_4241
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Other DBs
NCBI-ProteinID: AFO50070
UniProt: I7B4R5
LinkDB
Position
4617215..4617973
AA seq 252 aa
MRLKDKVAIVTGAATGIGNAIVRSYLAEGAKVVIADVKGAEAAAAELGEDLALGVFADVS
DPDSTKQMAKAALDRFGKIDVLVNNAGIFTGLNYVPMESISVADWDKLYSVNVKGPWLCA
SAVSAAMREGGGGKIINIASVIAHIGAPFMLHYVSSKGAVAAMTRAMAREFATTKAGISV
NSISPGYTHSENALANAQQHEQFEGVSASMRAIDRPQVPADIAGVALWLASDEASYVNGQ
NIVVDGGIYMSL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgagactgaaagacaaagtcgcaatcgtgactggtgcggcaaccgggattggcaacgct
atcgtgcgctcttaccttgctgagggtgcgaaggtggtcattgctgatgtgaaaggtgct
gaggcagccgcggcggaactgggtgaagacctagcgttgggtgtctttgccgacgtttcg
gatcctgatagcaccaagcagatggcaaaggcagcactggatcgcttcggcaagatcgac
gtgctcgtcaacaatgccggtatcttcaccggtctcaactatgtcccgatggaatcgatc
tcggttgcggattgggacaagctctacagtgtcaatgtcaaggggccctggctgtgcgcc
agtgcggtgtcggccgcgatgcgcgagggtggtggtggcaagatcatcaacatcgcctca
gtaatcgctcacatcggagcgcccttcatgttgcactacgtttccagcaagggcgctgtt
gcggcgatgacacgtgccatggcgcgcgaatttgcgacgaccaaggcagggatcagcgtc
aactccatctctcccggctacacccattcggaaaatgcgctcgcaaacgctcagcagcat
gagcagttcgagggcgtttctgcgtccatgcgggcaatcgatcgaccgcaagtgccggca
gatattgcgggagtggcgctttggttggctagcgacgaagcctcctacgtaaacgggcag
aacattgtggtggatggcggcatttacatgagcctctga

DBGET integrated database retrieval system