Pseudomonas putida DOT-T1E: T1E_4349 Help Entry T1E_4349          CDS       T02181                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism ppx  Pseudomonas putida DOT-T1E Brite KEGG Orthology (KO) [BR:ppx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppx03036]     T1E_4349 Chromosome and associated proteins [BR:ppx03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     T1E_4349 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL Motif Other DBs NCBI-ProteinID:  AFO50178 UniProt:  I7BER0 LinkDB All DBs Position 4728546..4728794 Genome browser AA seq 82 aa AA seqDB search MLLLFVGVLVSAIAVSYSAHWNRQLLNTLYGELNERDKAQAEWGRLILEQSTWTAASRIE SLASEQLKMRVPSADEVRMVAP NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcttctgctgtttgtcggcgtgctggtttcggccattgccgtgtcctacagtgcgcac tggaaccgtcaactgctcaacaccctgtacggtgaattgaacgagcgcgacaaggctcag gccgagtggggccggctgattcttgagcagagtacctggactgctgccagccgcatcgag agcctggcctccgagcagttgaagatgcgcgtgccatcagctgacgaagtccggatggtg gcgccatga

DBGET integrated database retrieval system