Pseudomonas putida DOT-T1E: T1E_4380 Help Entry T1E_4380          CDS       T02181                                  Symbol groES Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism ppx  Pseudomonas putida DOT-T1E Brite KEGG Orthology (KO) [BR:ppx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ppx03110]     T1E_4380 (groES)    03029 Mitochondrial biogenesis [BR:ppx03029]     T1E_4380 (groES) Chaperones and folding catalysts [BR:ppx03110]  Heat shock proteins   HSP10    T1E_4380 (groES) Mitochondrial biogenesis [BR:ppx03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     T1E_4380 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  AFO50209 UniProt:  I7CEA0 LinkDB All DBs Position 4763217..4763510 Genome browser AA seq 97 aa AA seqDB search MKLRPLHDRVVIRRSEEESKTAGGIVLPGSAAEKPNRGEVVAVGTGRVLDNGEVRALAVK VGDKVVFGPYSGSNTVKVDGEDLLVMAENEILAVVEG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaaacttcgtcctctgcatgaccgcgtagtcatccgtcgcagcgaagaagaatcgaaa accgctggcggtatcgtcctgccgggttcggccgctgaaaaaccaaaccgcggcgaagtt gtagccgtcggcaccggtcgcgtcctggacaacggcgaagttcgcgcgctggccgtgaaa gtgggtgacaaagtggttttcggcccgtactcgggcagcaacaccgtgaaagtcgatggc gaagacctgctggtcatggccgagaacgaaatcctcgccgttgttgaaggctga

DBGET integrated database retrieval system