KEGG   Pseudomonas putida DOT-T1E: T1E_4628
Entry
T1E_4628          CDS       T02181                                 
Name
(GenBank) taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00430  Taurine and hypotaurine metabolism
ppx00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    T1E_4628
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    T1E_4628
Enzymes [BR:ppx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     T1E_4628
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: AFO50455
UniProt: I7B5Q3
LinkDB
Position
5059563..5060396
AA seq 277 aa
MSLTITPLSPALGAQISGVDISRDISAEERDAIEQALLQHQVLFLRDQPINPEQQARFAA
RFGDLHIHPIYPNVPDTPQVLVLDTAVTDVRDNAVWHTDVTFLPTPALGAVLSAKQLPAY
GGDTLWASGIAAFEALSAPLREMLDGLTATHDFTKSFPLERFGTTPEDLARWEATRRNNP
PLSHPVVRTHPVSGRKALFVNEGFTTRINELSELESDALLRLLFAHATRPEFSIRWRWQE
HDVAFWDNRVTQHFAVDDYRPNRRVMHRATILGDAPF
NT seq 834 nt   +upstreamnt  +downstreamnt
atgagcctgaccatcactcccctaagcccagcactcggcgcccagatcagcggcgtggac
atcagccgcgatatcagcgcagaagagcgcgatgccatcgaacaggcactgctccagcac
caggtgctgttcctccgtgaccagccgatcaacccggaacagcaggcgcgctttgccgca
cgcttcggcgacctgcacatccacccgatttaccccaacgtgccggacaccccgcaggtg
ctggtgctcgacacggcggttaccgatgtgcgcgacaacgccgtgtggcacaccgacgtg
acctttttgccgaccccggcactgggcgcggtactcagcgccaagcaattgcctgcttac
ggtggcgataccctttgggccagcggcattgcggccttcgaggccttgtcggcgccgctg
cgtgaaatgctggacgggctgaccgctacccacgacttcaccaagtcgttcccgctggag
cgctttggcaccacgccggaagacctggcgcgctgggaggccacccggcgcaacaacccg
ccgctgtcgcacccggtggtgcgtacgcatccggtgagcgggcgcaaggcgttgttcgtc
aatgaagggttcactacacgcatcaatgaactgagcgaactggaaagcgatgcgctgctg
aggctgctgttcgcccatgcgacgcgaccggagttcagcattcgctggcgttggcaggag
catgacgtggcgttctgggacaaccgcgtgacccagcattttgcggtggatgattaccgg
ccgaaccggcgggtgatgcaccgggcaaccatccttggggatgcccccttctag

DBGET integrated database retrieval system