Pongo pygmaeus (Bornean orangutan): 129006092 Help Entry 129006092         CDS       T10128                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04621   NOD-like receptor signaling pathway ppyg05012   Parkinson disease ppyg05132   Salmonella infection ppyg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ppyg00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     129006092  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129006092   09164 Neurodegenerative disease    05012 Parkinson disease     129006092   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     129006092  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ppyg03110]     129006092 Chaperones and folding catalysts [BR:ppyg03110]  Protein folding catalysts   Protein disulfide isomerase    129006092 SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 Redoxin DIM1 A6-like_Thioredoxin-like_C Motif Other DBs NCBI-GeneID:  129006092 NCBI-ProteinID:  XP_054291333 LinkDB All DBs Position 8:complement(125079831..125081815) Genome browser AA seq 105 aa AA seqDB search MVKQIRSKVAFQEGSEAAGDKLVIVDFSAMWCGPCKKIKLFFHSLSEKYSNMVFFEVHVA DCQDVASECEAKCMPTFQFFVKGQKVGEFSGANKEKLEATINELV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcaaattaggagcaaggttgcttttcaggaaggctcagaggctgcaggtgat aaacttgtcatagttgacttctcagccatgtggtgtgggccttgcaaaaagatcaagctt ttctttcattccctctctgaaaagtattccaacatggtattctttgaagtacatgtggct gactgtcaggatgttgcttcagaatgtgaagccaaatgcatgccaaccttccagtttttt gttaagggacaaaaggtgggtgaattttctggagctaataaggaaaagcttgaagccacc attaatgaattagtctaa

DBGET integrated database retrieval system